PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna26007.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 359aa    MW: 39848.1 Da    PI: 7.2245
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna26007.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  mrna26007.1-v1.0-hybrid 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLMRCSKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding48.22.5e-1567112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++T  E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  mrna26007.1-v1.0-hybrid  67 RGNFTDHEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.06965IPR017930Myb domain
SuperFamilySSF466893.16E-3011108IPR009057Homeodomain-like
SMARTSM007172.1E-131363IPR001005SANT/Myb domain
PfamPF002496.5E-161461IPR001005SANT/Myb domain
CDDcd001671.93E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129419.21666116IPR017930Myb domain
SMARTSM007174.0E-1566114IPR001005SANT/Myb domain
PfamPF002499.6E-1467112IPR001005SANT/Myb domain
CDDcd001677.42E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010468Biological Processregulation of gene expression
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDHEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLRKLQ  120
TGSAEDGISG TSQQPISKGQ WERRLQTDIH MAKQALCEAL SLDKPSHDHH HVPDLKPSLS  180
NINATTSTTA TTRTHQASTY ASNTENIARL LENWMKNSPK VRTNSSDDHQ SHVHHQNMLS  240
NGSCSSTTDG AHSGTTTTPD HQDHQGFDSL FSSFNSSTLS DNTSTQLSAG NNHRHASTTT  300
NNNNTSLMMF QDESKPNLEE TVAAAAAEAA DQVPLTLLEK WLLDDASAHQ AHDQDILF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-251411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00579DAPTransfer from AT5G62470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0016701e-121KM001670.1 Pyrus x bretschneideri transcription factor MYB31 (MYB31) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004299363.10.0PREDICTED: myb-related protein 306-like isoform X1
SwissprotP813921e-128MYB06_ANTMA; Myb-related protein 306
TrEMBLM5WUN21e-159M5WUN2_PRUPE; Uncharacterized protein
STRINGGLYMA04G33720.11e-132(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.11e-106myb domain protein 94